MTNR1A, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-104-952	50 μL

Catalog No. 89-104-952 Supplier Abnova Corporation Supplier No. H00004543A01

Description

Mouse polyclonal antibody raised against a partial recombinant MTNR1A.

This gene encodes one of two high affinity forms of a receptor for melatonin, the primary hormone secreted by the pineal gland. This receptor is a G-protein coupled, 7-transmembrane receptor that is responsible for melatonin effects on mammalian circadian rhythm and reproductive alterations affected by day length. The receptor is an integral membrane protein that is readily detectable and localized to two specific regions of the brain. The hypothalamic suprachiasmatic nucleus appears to be involved in circadian rhythm while the hypophysial pars tuberalis may be responsible for the reproductive effects of melatonin. [provided by RefSeq

Sequence: GLLNQNFRKEYRRIIVSLCTARVFFVDSSNDVADRVKWKPSPLMTNNNVVKVDSV

Specifications

• Antigen: MTNR1A
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant MTNR1A.
• Formulation: 50% glycerol
• Gene: MTNR1A
• Gene Accession No.: NM_005958
• Gene Alias: MEL-1A-R/MT1
• Gene Symbols: MTNR1A
• Host Species: Mouse
• Immunogen: MTNR1A (NP_005949, 296 a.a. ∽ 350 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 4543
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only