MUC1, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-104-953	50 μL

Catalog No. 89-104-953 Supplier Abnova Corporation Supplier No. H00004582A01

Description

Mouse polyclonal antibody raised against a partial recombinant MUC1.

This gene is a member of the mucin family and encodes a membrane bound, glycosylated phosphoprotein. The protein is anchored to the apical surface of many epithelia by a transmembrane domain, with the degree of glycosylation varying with cell type. It also includes a 20 aa variable number tandem repeat (VNTR) domain, with the number of repeats varying from 20 to 120 in different individuals. The protein serves a protective function by binding to pathogens and also functions in a cell signaling capacity. Overexpression, aberrant intracellular localization, and changes in glycosylation of this protein have been associated with carcinomas. Multiple alternatively spliced transcript variants that encode different isoforms of this gene have been reported, but the full-length nature of only some has been determined. [provided by RefSeq

Sequence: NSSLEDPSTDYYQELQRDISEMFLQIYKQGGFLGLSNIKFRPGSVVVQLTLAFREGTINVHDMETQFNQYKTEAASRYNLTISDVSVSDVPFPFSAQSGAGVPGWG

Specifications

• Antigen: MUC1
• Applications: ELISA
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant MUC1.
• Formulation: 50% glycerol
• Gene: MUC1
• Gene Accession No.: NM_182741.1
• Gene Alias: CD227/EMA/H23AG/MAM6/PEM/PEMT/PUM
• Gene Symbols: MUC1
• Host Species: Mouse
• Immunogen: MUC1 (NP_877418.1, 315 a.a. ∽ 420 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 4582
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only