MUC4, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-104-954	50 μL

Catalog No. 89-104-954 Supplier Abnova Corporation Supplier No. H00004585A01

Description

Mouse polyclonal antibody raised against a partial recombinant MUC4.

The major constituents of mucus, the viscous secretion that covers epithelial surfaces such as those in the trachea, colon, and cervix, are highly glycosylated proteins called mucins. These glycoproteins play important roles in the protection of the epithelial cells and have been implicated in epithelial renewal and differentiation. This gene encodes an integral membrane glycoprotein found on the cell surface, although secreted isoforms may exist. At least two dozen transcript variants of this gene have been found, although for many of them the full-length transcript has not been determined or they are found only in tumor tissues. This gene contains a region in the coding sequence which has a variable number (>100) of 48 nt tandem repeats. [provided by RefSeq

Sequence: GVSLFPYGADAGDLEFVRRTVDFTSPLFKPATGFPLGSSLRDSLYFTDNGQIIFPESDYQIFSYPNPLPTGFTGRDPVALVAPFWDDADFSTGRGTTFYQEYETFYGEHS

Specifications

• Antigen: MUC4
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant MUC4.
• Formulation: 50% glycerol
• Gene: MUC4
• Gene Accession No.: NM_004532
• Gene Alias: HSA276359
• Gene Symbols: MUC4
• Host Species: Mouse
• Immunogen: MUC4 (NP_004523, 79 a.a. ∽ 188 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 4585
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only