MUC7, Mouse, Clone: 7F2, Abnova™

Catalog No.	Quantity
89-104-957	200 μL

Catalog No. 89-104-957 Supplier Abnova Corporation Supplier No. H00004589M06A

Description

Mouse monoclonal antibody raised against a partial recombinant MUC7.

This gene encodes a small salivary mucin, which is thought to play a role in facilitating the clearance of bacteria in the oral cavity and to aid in mastication, speech, and swallowing. The central domain of this glycoprotein contains tandem repeats, each composed of 23 amino acids. The most common allele contains 6 repeats, and some alleles may be associated with susceptibility to asthma. Alternatively spliced transcript variants with different 5' UTR, but encoding the same protein, have been found for this gene

Sequence: HQSPKSHFELPHYPGLLAHQKPFIRKSYKCLHKRCRPKLPPSPNNPPKFPNPHQPPKHPDKNSSVVNPTLVATTQIPSVTFPSASTKITTLPNVTFLPQN

Specifications

• Antigen: MUC7
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 7F2
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant MUC7.
• Formulation: ascites with no preservative
• Gene: MUC7
• Gene Accession No.: NM_152291
• Gene Alias: DKFZp686J03256/FLJ27047/MG2/MGC34772
• Gene Symbols: MUC7
• Host Species: Mouse
• Immunogen: MUC7 (NP_689504,36 a.a. ∽ 135 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 200 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 4589
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Ascites
• Isotype: IgG2a κ