MYO3A, Mouse, Clone: 8H2, Abnova™

Catalog No.	Quantity
89-106-950	200 μL

Catalog No. 89-106-950 Supplier Abnova Corporation Supplier No. H00053904M08A

Description

Mouse monoclonal antibody raised against a partial recombinant MYO3A.

The protein encoded by this gene belongs to the myosin superfamily. Myosins are actin-dependent motor proteins and are categorized into conventional myosins (class II) and unconventional myosins (classes I and III through XV) based on their variable C-terminal cargo-binding domains. Class III myosins, such as this one, have a kinase domain N-terminal to the conserved N-terminal motor domains and are expressed in photoreceptors. The protein encoded by this gene plays an important role in hearing in humans. Three different recessive, loss of function mutations in the encoded protein have been shown to cause nonsyndromic progressive hearing loss. Expression of this gene is highly restricted, with the strongest expression in retina and cochlea. [provided by RefSeq

Sequence: HEEINNIKKKDNKDSKATSEREACGLAIFSKQISKLSEEYFILQKKLNEMILSQQLKSLYLGVSHHKPINRRVSSQQCLSGVCKGEEPKIL

Specifications

• Antigen: MYO3A
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 8H2
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant MYO3A.
• Formulation: ascites with no preservative
• Gene: MYO3A
• Gene Accession No.: NM_017433
• Gene Alias: DFNB30
• Gene Symbols: MYO3A
• Host Species: Mouse
• Immunogen: MYO3A (NP_059129,1400 a.a. ∽ 1490 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 200 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 53904
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Ascites
• Isotype: IgG2b