MYO3A, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-106-948	50 μL

Catalog No. 89-106-948 Supplier Abnova Corporation Supplier No. H00053904A01

Description

Mouse polyclonal antibody raised against a partial recombinant MYO3A.

The protein encoded by this gene belongs to the myosin superfamily. Myosins are actin-dependent motor proteins and are categorized into conventional myosins (class II) and unconventional myosins (classes I and III through XV) based on their variable C-terminal cargo-binding domains. Class III myosins, such as this one, have a kinase domain N-terminal to the conserved N-terminal motor domains and are expressed in photoreceptors. The protein encoded by this gene plays an important role in hearing in humans. Three different recessive, loss of function mutations in the encoded protein have been shown to cause nonsyndromic progressive hearing loss. Expression of this gene is highly restricted, with the strongest expression in retina and cochlea. [provided by RefSeq

Sequence: HEEINNIKKKDNKDSKATSEREACGLAIFSKQISKLSEEYFILQKKLNEMILSQQLKSLYLGVSHHKPINRRVSSQQCLSGVCKGEEPKIL

Specifications

• Antigen: MYO3A
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant MYO3A.
• Formulation: 50% glycerol
• Gene: MYO3A
• Gene Accession No.: NM_017433
• Gene Alias: DFNB30
• Gene Symbols: MYO3A
• Host Species: Mouse
• Immunogen: MYO3A (NP_059129, 1400 a.a. ∽ 1490 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 53904
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only