MYO7A, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-104-970	50 μL

Catalog No. 89-104-970 Supplier Abnova Corporation Supplier No. H00004647A01

Description

Mouse polyclonal antibody raised against a partial recombinant MYO7A.

This gene is a member of the myosin gene family. Myosins are mechanochemical proteins characterized by the presence of a motor domain, an actin-binding domain, a neck domain that interacts with other proteins, and a tail domain that serves as an anchor. This gene encodes an unconventional myosin with a very short tail. Defects in this gene are associated with the mouse shaker-1 phenotype and the human Usher syndrome 1B which are characterized by deafness, reduced vestibular function, and (in human) retinal degeneration. Alternative splicing results in multiple transcript variants. [provided by RefSeq

Sequence: KQTTEPNFPEILLIAINKYGVSLIDPKTKDILTTHPFTKISNWSSGNTYFHITIGNLVRGSKLLCETSLGYKMDDLLTSYISQMLTAMSKQRGSRS

Specifications

• Antigen: MYO7A
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant MYO7A.
• Formulation: 50% glycerol
• Gene: MYO7A
• Gene Accession No.: NM_000260
• Gene Alias: DFNA11/DFNB2/MYOVIIA/MYU7A/NSRD2/USH1B
• Gene Symbols: MYO7A
• Host Species: Mouse
• Immunogen: MYO7A (NP_000251, 2118 a.a. ∽ 2213 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 4647
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only