NAGPA, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-106-862	50 μL

Catalog No. 89-106-862 Supplier Abnova Corporation Supplier No. H00051172A01

Description

Mouse polyclonal antibody raised against a partial recombinant NAGPA.

Hydrolases are transported to lysosomes after binding to mannose 6-phosphate receptors in the trans-Golgi network. This gene encodes the enzyme that catalyzes the second step in the formation of the mannose 6-phosphate recognition marker on lysosomal hydrolases. Commonly known as 'uncovering enzyme' or UCE, this enzyme removes N-acetyl-D-glucosamine (GlcNAc) residues from GlcNAc-alpha-P-mannose moieties and thereby produces the recognition marker. This reaction most likely occurs in the trans-Golgi network. This enzyme functions as a homotetramer of two disulfide-linked homodimers. In addition to having an N-terminal signal peptide, the protein's C-terminus contains multiple signals for trafficking it between lysosomes, the plasma membrane, and trans-Golgi network. [provided by RefSeq]

Sequence: DNMWRCPRQVSTVVCVHEPRCQPPDCHGHGTCVDGHCQCTGHFWRGPGCDELDCGPSNCSQHGLCTETGCRCDAGWTGSNCSEECPLGWHGPGCQRPCKC

Specifications

• Antigen: NAGPA
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant NAGPA.
• Formulation: 50% glycerol
• Gene: NAGPA
• Gene Accession No.: NM_016256
• Gene Alias: APAA/UCE
• Gene Symbols: NAGPA
• Host Species: Mouse
• Immunogen: NAGPA (NP_057340, 309 a.a. ∽ 408 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 51172
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only