NCAPG2 (LUZP5), Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant LUZP5.

Supplier:  Abnova Corporation H00054892A01

Catalog No. 89-106-993

Description

Condensin complexes I and II play essential roles in mitotic chromosome assembly and segregation. Both condensins contain 2 invariant structural maintenance of chromosome (SMC) subunits, SMC2 (MIM 605576) and SMC4 (MIM 605575), but they contain different sets of non-SMC subunits. NCAPG2 is 1 of 3 non-SMC subunits that define condensin II (Ono et al., 2003 [PubMed 14532007]).[supplied by OMIM

Sequence: TKTGADVCRLWRIHQALYCFDYDLEESGEIKDMLLECFININYIKKEEGRRFLSCLFNWNINFIKMIHGTIKNQLQGLQKSLMVYIAEIYFRAWKKAS

Specifications

• Antigen: NCAPG2 (LUZP5)
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a partial recombinant LUZP5.
• Gene: NCAPG2
• Gene Alias: CAP-G2/FLJ20311/LUZP5/MTB/hCAP-G2
• Host Species: Mouse
• Quantity: 50 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Antisera

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: NM_017760
• Gene Symbols: NCAPG2
• Immunogen: LUZP5 (NP_060230, 177 a.a. ∽ 274 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Gene ID (Entrez): 54892
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

For Research Use Only