Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

NCOA4, Mouse, Clone: 1A2, Abnova™

Catalog No. 89105804 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
200 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-105-804 200 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-105-804 Supplier Abnova Corporation Supplier No. H00008031M02A
Add to Cart
Add to Cart

Mouse monoclonal antibody raised against a partial recombinant NCOA4.

This gene encodes an androgen receptor coactivator. The encoded protein interacts with the androgen receptor in a ligand-dependent manner to enhance its transcriptional activity. Chromosomal translocations between this gene and the ret tyrosine kinase gene, also located on chromosome 10, have been associated with papillary thyroid carcinoma. Alternatively spliced transcript variants have been described. Pseudogenes are present on chromosomes 4, 5, 10, and 14. [provided by RefSeq

Sequence: EGSPKEVPGTEDRAGKQKFKSPMNTSWCSFNTADWVLPGKKMGNLSQLSSGEDKWLLRKKAQEVLLNSPLQEEHNFPPDHYGLPAVCDLFACMQLKVDKEKWLYRTPLQM

Specifications

Antigen NCOA4
Applications ELISA, Western Blot
Classification Monoclonal
Clone 1A2
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant NCOA4.
Formulation ascites with no preservative
Gene NCOA4
Gene Accession No. NM_005437
Gene Alias ARA70/DKFZp762E1112/ELE1/PTC3/RFG
Gene Symbols NCOA4
Host Species Mouse
Immunogen NCOA4 (NP_005428,505 a.a. ∽ 614 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Quantity 200 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 8031
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Ascites
Isotype IgG1 κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.