NCOA4, Mouse, Clone: 1A2, Abnova™

Mouse monoclonal antibody raised against a partial recombinant NCOA4.

Supplier:  Abnova Corporation H00008031M02A

Catalog No. 89-105-804

Description

This gene encodes an androgen receptor coactivator. The encoded protein interacts with the androgen receptor in a ligand-dependent manner to enhance its transcriptional activity. Chromosomal translocations between this gene and the ret tyrosine kinase gene, also located on chromosome 10, have been associated with papillary thyroid carcinoma. Alternatively spliced transcript variants have been described. Pseudogenes are present on chromosomes 4, 5, 10, and 14. [provided by RefSeq

Sequence: EGSPKEVPGTEDRAGKQKFKSPMNTSWCSFNTADWVLPGKKMGNLSQLSSGEDKWLLRKKAQEVLLNSPLQEEHNFPPDHYGLPAVCDLFACMQLKVDKEKWLYRTPLQM

Specifications

• Antigen: NCOA4
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: ascites with no preservative
• Gene Accession No.: NM_005437
• Gene Symbols: NCOA4
• Immunogen: NCOA4 (NP_005428,505 a.a. ∽ 614 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Regulatory Status: RUO
• Gene ID (Entrez): 8031
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Ascites

• Applications: ELISA, Western Blot
• Clone: 1A2
• Description: Mouse monoclonal antibody raised against a partial recombinant NCOA4.
• Gene: NCOA4
• Gene Alias: ARA70/DKFZp762E1112/ELE1/PTC3/RFG
• Host Species: Mouse
• Quantity: 200 μL
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody
• Isotype: IgG1 κ