Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89106754

NDOR1, Mouse, Clone: 3A11, Abnova™

Catalog No. 89106754 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
200 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-106-754 200 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-106-754 Supplier Abnova Corporation Supplier No. H00027158M01A
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a partial recombinant NDOR1.

This gene encodes an NADPH-dependent diflavin reductase that contains both flavin mononucleotide (FMN) and flavin adenine dinucleotide (FAD) binding domains. The encoded protein is an enzyme that catalyzes the transfers electrons from NADPH through FAD and FMN cofactors to potential redox partners. Alternative splicing results in multiple transcript variants. [provided by RefSeq

Sequence: EWQELEKRDCLTLIPAFSREQEQKVYVQHRLRELGSLVWELLDRQGAYFYLAGNAKSMPADVSEALMSIFQEEGGLCSPDAAAYLARLQQTRRFQTET

Specifications

Antigen NDOR1
Applications ELISA, Western Blot
Classification Monoclonal
Clone 3A11
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant NDOR1.
Formulation ascites with no preservative
Gene NDOR1
Gene Accession No. NM_014434
Gene Alias MGC138148/NR1/bA350O14.9
Gene Symbols NDOR1
Host Species Mouse
Immunogen NDOR1 (NP_055249,498 a.a. ∽ 595 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Quantity 200 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 27158
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Ascites
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.