Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

NEUROD6, Mouse, Clone: 4G11, Abnova™

Mouse monoclonal antibody raised against a partial recombinant NEUROD6.

Manufacturer:  Abnova Corporation H00063974M02A

Catalog No. 89-107-262


Add to cart

Description

Description

NEUROD6 is a member of the NEUROD (NEUROD1; MIM 601724) family of basic helix-loop-helix (bHLH) transcription factors (Guo et al., 2002 [PubMed 12357074]).[supplied by OMIM

Sequence: GQGGEAAHHTRSPYSTFYPPYHSPELTTPPGHGTLDNSKSMKPYNYCSAYESFYESTSPECASPQFEGPLSPPPINYNGIFSLKQEETLDYGKNYNYGMH
Specifications

Specifications

NEUROD6
Monoclonal
Unconjugated
ascites with no preservative
NM_022728
Atoh2/MATH2/Math-2/NEX1M/bHLHa2
Mouse
IgG2a Kappa
RUO
Antibody
Monoclonal
Human
ELISA, Western Blot
4G11
Mouse monoclonal antibody raised against a partial recombinant NEUROD6.
NEUROD6
Ascites
NEUROD6
NEUROD6 (NP_073565.2,191 a.a. ∽ 290 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
200 uL
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Primary
63974
SDS
Documents
Product Certifications
Promotions

Promotions

Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit