Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89107261

NEUROG2, Mouse, Clone: 1D2, Abnova™

Catalog No. 89107261 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
200 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-107-261 200 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-107-261 Supplier Abnova Corporation Supplier No. H00063973M12A
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a partial recombinant NEUROG2.

Neurogenin-2 is a member of the neurogenin subfamily of basic helix-loop-helix (bHLH) transcription factor genes that play an important role in neurogenesis from migratory neural crest cells.[supplied by OMIM

Sequence: CRPARLLGLVHDCKRRPSRARAVSRGAKTAETVQRIKKTRRLKANNRERNRMHNLNAALDALREVLPTFPEDAKLTKIETLRFAHNYIWALTETLRLADHCG

Specifications

Antigen NEUROG2
Applications ELISA
Classification Monoclonal
Clone 1D2
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant NEUROG2.
Formulation ascites with no preservative
Gene NEUROG2
Gene Accession No. NM_024019
Gene Alias Atoh4/MGC46562/Math4A/NGN2/bHLHa8/ngn-2
Gene Symbols NEUROG2
Host Species Mouse
Immunogen NEUROG2 (NP_076924,74 a.a. ∽ 175 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Quantity 200 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 63973
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Ascites
Isotype IgG2b κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.