NEUROG2, Mouse, Clone: 1D2, Abnova™

Mouse monoclonal antibody raised against a partial recombinant NEUROG2.

Supplier:  Abnova Corporation H00063973M12A

Catalog No. 89-107-261

Description

Neurogenin-2 is a member of the neurogenin subfamily of basic helix-loop-helix (bHLH) transcription factor genes that play an important role in neurogenesis from migratory neural crest cells.[supplied by OMIM

Sequence: CRPARLLGLVHDCKRRPSRARAVSRGAKTAETVQRIKKTRRLKANNRERNRMHNLNAALDALREVLPTFPEDAKLTKIETLRFAHNYIWALTETLRLADHCG

Specifications

• Antigen: NEUROG2
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: ascites with no preservative
• Gene Accession No.: NM_024019
• Gene Symbols: NEUROG2
• Immunogen: NEUROG2 (NP_076924,74 a.a. ∽ 175 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Regulatory Status: RUO
• Gene ID (Entrez): 63973
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Ascites

• Applications: ELISA
• Clone: 1D2
• Description: Mouse monoclonal antibody raised against a partial recombinant NEUROG2.
• Gene: NEUROG2
• Gene Alias: Atoh4/MGC46562/Math4A/NGN2/bHLHa8/ngn-2
• Host Species: Mouse
• Quantity: 200 μL
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody
• Isotype: IgG2b κ