Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89104988

NFE2L1, Mouse, Polyclonal Antibody, Abnova™

Catalog No. 89104988 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
50 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-104-988 50 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-104-988 Supplier Abnova Corporation Supplier No. H00004779A01
Add to Cart
Add to Cart

Description

Mouse polyclonal antibody raised against a partial recombinant NFE2L1.

This gene encodes a protein that is involved in globin gene expression in erythrocytes. Confusion has occurred in bibliographic databases due to the shared symbol of NRF1 for this gene, NFE2L1, and for nuclear respiratory factor 1 which has an official symbol of NRF1. [provided by RefSeq]

Sequence: DTILNLERDVEDLQRDKARLLREKVEFLRSLRQMKQKVQSLYQEVFGRLRDENGRPYSPSQYALQYAGDGSVLLIPRTMADQQARRQERKPKDRR

Specifications

Antigen NFE2L1
Applications ELISA, Western Blot
Classification Polyclonal
Conjugate Unconjugated
Description Mouse polyclonal antibody raised against a partial recombinant NFE2L1.
Formulation 50% glycerol
Gene NFE2L1
Gene Accession No. NM_003204
Gene Alias FLJ00380/LCR-F1/NRF1/TCF11
Gene Symbols NFE2L1
Host Species Mouse
Immunogen NFE2L1 (NP_003195, 677 a.a. ∽ 771 a.a) partial recombinant protein with GST tag.
Quantity 50 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 4779
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Form Antisera
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.