NFKBIE, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-104-993	50 μL

Catalog No. 89-104-993 Supplier Abnova Corporation Supplier No. H00004794A01

Description

Mouse polyclonal antibody raised against a partial recombinant NFKBIE.

NFKB1 (MIM 164011) or NFKB2 (MIM 164012) is bound to REL (MIM 164910), RELA (MIM 164014), or RELB (MIM 604758) to form the NFKB complex. The NFKB complex is inhibited by I-kappa-B proteins (NFKBIA, MIM 164008 or NFKBIB, MIM 604495), which inactivate NF-kappa-B by trapping it in the cytoplasm. Phosphorylation of serine residues on the I-kappa-B proteins by kinases (IKBKA, MIM 600664, or IKBKB, MIM 603258) marks them for destruction via the ubiquitination pathway, thereby allowing activation of the NF-kappa-B complex. Activated NFKB complex translocates into the nucleus and binds DNA at kappa-B-binding motifs such as 5-prime GGGRNNYYCC 3-prime or 5-prime HGGARNYYCC 3-prime (where H is A, C, or T; R is an A or G purine; and Y is a C or T pyrimidine). For some genes, activation requires NFKB interaction with other transcription factors, such as STAT (see STAT6, MIM 601512), AP1 (JUN, MIM 165160), and NFAT (see NFATC1, MIM 600489).[supplied by OMIM

Sequence: SGKTALHLAVETQERGLVQFLLQAGAQVDARMLNGCTPLHLAAGRGLMGISSTLCKAGADSLLRNVEDETPQDLTEESLVLLPFDDLKISGKLLLC

Specifications

• Antigen: NFKBIE
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant NFKBIE.
• Formulation: 50% glycerol
• Gene: NFKBIE
• Gene Accession No.: NM_004556
• Gene Alias: IKBE
• Gene Symbols: NFKBIE
• Host Species: Mouse
• Immunogen: NFKBIE (NP_004547, 403 a.a. ∽ 498 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 4794
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only