NFYC, Mouse, Clone: 1D3, Abnova™

Catalog No.	Quantity
89-105-000	200 μL

Catalog No. 89-105-000 Supplier Abnova Corporation Supplier No. H00004802M01A

Description

Mouse monoclonal antibody raised against a partial recombinant NFYC.

This gene encodes one subunit of a trimeric complex forming a highly conserved transcription factor that binds with high specificity to CCAAT motifs in the promoters of a variety of genes. The encoded protein, subunit C, forms a tight dimer with the B subunit, a prerequisite for subunit A association. The resulting trimer binds to DNA with high specificity and affinity. Subunits B and C each contain a histone-like motif. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq

Sequence: DAQQSLQSFWPRVMEEIRNLTVKDFRVQELPLARIKKIMKLDEDVKMISAEAPVLFAKAAQIFITELTLRAWIHTEDNKRRTLQRNDIAMAITKFDQFDF

Specifications

• Antigen: NFYC
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 1D3
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant NFYC.
• Formulation: ascites with no preservative
• Gene: NFYC
• Gene Accession No.: BC005003.1
• Gene Alias: CBF-C/CBFC/DKFZp667G242/FLJ45775/H1TF2A/HAP5/HSM/NF-YC
• Gene Symbols: NFYC
• Host Species: Mouse
• Immunogen: NFYC (AAH05003.1,14 a.a. ∽ 113 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 200 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 4802
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Ascites
• Isotype: IgG1 κ