Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89105001

NHP2L1, Mouse, Polyclonal Antibody, Abnova™

Catalog No. 89105001 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
50 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-105-001 50 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-105-001 Supplier Abnova Corporation Supplier No. H00004809A01
Add to Cart
Add to Cart

Description

Mouse polyclonal antibody raised against a partial recombinant NHP2L1.

Originally named because of its sequence similarity to the Saccharomyces cerevisiae NHP2 (nonhistone protein 2), this protein appears to be a highly conserved nuclear protein that is a component of the [U4/U6.U5] tri-snRNP. It binds to the 5' stem-loop of U4 snRNA. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq]

Sequence: MTEADVNPKAYPLADAHLTKKLLDLVQQSCNYKQLRKGANEATKTLNRGISEFIVMAADAEPLEIILHLPLLCEDKNVPYVFVRSKQALGRACGVSRPVI

Specifications

Antigen NHP2L1
Applications ELISA, Western Blot
Classification Polyclonal
Conjugate Unconjugated
Description Mouse polyclonal antibody raised against a partial recombinant NHP2L1.
Formulation 50% glycerol
Gene NHP2L1
Gene Accession No. BC005358
Gene Alias 15.5K/FA-1/FA1/NHPX/OTK27/SNRNP15-5/SNU13/SPAG12/SSFA1
Gene Symbols NHP2L1
Host Species Mouse
Immunogen NHP2L1 (AAH05358, 1 a.a. ∽ 100 a.a) partial recombinant protein with GST tag.
Quantity 50 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 4809
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Form Antisera
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.