Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

NME1, Mouse, Clone: 1D7, Abnova™

Mouse monoclonal antibody raised against a partial recombinant NME1.

Manufacturer:  Abnova Corporation H00004830M02A

Catalog No. 89-105-006


Add to cart

Description

Description

This gene (NME1) was identified because of its reduced mRNA transcript levels in highly metastatic cells. Nucleoside diphosphate kinase (NDK) exists as a hexamer composed of 'A' (encoded by this gene) and 'B' (encoded by NME2) isoforms. Mutations in this gene have been identified in aggressive neuroblastomas. Two transcript variants encoding different isoforms have been found for this gene. Co-transcription of this gene and the neighboring downstream gene (NME2) generates naturally-occurring transcripts (NME1-NME2), which encodes a fusion protein comprised of sequence sharing identity with each individual gene product. [provided by RefSeq

Sequence: ASEDLLKEHYVDLKDRPFFAGLVKYMHSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVESAEKEIGLWFHPEELVDYTSCAQNWIYE
Specifications

Specifications

NME1
Monoclonal
Unconjugated
ascites with no preservative
NM_000269
AWD/GAAD/NB/NBS/NDPK-A/NDPKA/NM23/NM23-H1
Mouse
IgG1 Kappa
RUO
Antibody
Monoclonal
Human
ELISA, Western Blot
1D7
Mouse monoclonal antibody raised against a partial recombinant NME1.
NME1
Ascites
NME1
NME1 (NP_000260,43 a.a. ∽ 152 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
200 uL
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Primary
4830
SDS
Documents
Product Certifications
Promotions

Promotions

Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit