Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

NOD1 (CARD4), Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant CARD4.

Manufacturer:  Abnova Corporation H00010392A01

Catalog No. 89-106-301


Add to cart

Description

Description

Sequence: MEEQGHSEMEIIPSESHPHIQLLKSNRELLVTHIRNTQCLVDNLLKNDYFSAEDAEIVCACPTQPDKVRKILDLVQSKGEEVSEFFLYLLQQL
Specifications

Specifications

NOD1 (CARD4)
Unconjugated
50% glycerol
BC040339
CARD4/CLR7.1/NLRC1
Mouse
50 uL
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Polyclonal
Human
ELISA, Western Blot
Mouse polyclonal antibody raised against a partial recombinant CARD4.
NOD1
Antisera
NOD1
CARD4 (AAH40339, 1 a.a. ∽ 93 a.a) partial recombinant protein with GST tag.
RUO
Primary
10392
SDS
Documents
Product Certifications
Promotions

Promotions

Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only