Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89105987

NOL3, Mouse, Clone: 6F5, Abnova™

Catalog No. 89105987 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
200 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-105-987 200 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-105-987 Supplier Abnova Corporation Supplier No. H00008996M03A
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a full-length recombinant NOL3.

Sequence: MGNAQERPSETIDRERKRLVETLQADSGLLLDALLARGVLTGPEYEALDALPDAERRVRRLLLLVQGKGEAACQELLRCAQRTAGAPDPAWDWQHVGPGYRDRSYDPPCPGHWTPEAPGSGTTCPGLPRASDPDEAGGPEGSEAVQSGTPEEPEPELEAEASKEAEPEPEPEPELEPEAEAEPEPELEPEPDPEPEPDFEERDESEDS

Specifications

Antigen NOL3
Applications ELISA, Western Blot
Classification Monoclonal
Clone 6F5
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a full-length recombinant NOL3.
Formulation ascites with no preservative
Gene NOL3
Gene Accession No. NM_003946.3
Gene Alias ARC/CARD2/MYC/MYP/NOP/NOP30
Gene Symbols NOL3
Host Species Mouse
Immunogen NOL3 (NP_003937.1,1 a.a. ∽ 208 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Quantity 200 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 8996
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Ascites
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.