NOTCH3, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-105-017	50 μL

Catalog No. 89-105-017 Supplier Abnova Corporation Supplier No. H00004854A01

Description

Mouse polyclonal antibody raised against a partial recombinant NOTCH3.

This gene encodes the third discovered human homologue of the Drosophilia melanogaster type I membrane protein notch. In Drosophilia, notch interaction with its cell-bound ligands (delta, serrate) establishes an intercellular signalling pathway that plays a key role in neural development. Homologues of the notch-ligands have also been identified in human, but precise interactions between these ligands and the human notch homologues remains to be determined. Mutations in NOTCH3 have been identified as the underlying cause of cerebral autosomal dominant arteriopathy with subcortical infarcts and leukoencephalopathy (CADASIL). [provided by RefSeq

Sequence: SPCANGGRCTQLPSREAACLCPPGWVGERCQLEDPCHSGPCAGRGVCQSSVVAGTARFSCRCPRGFRGPDCSLPDPCLSSPCAHGARCSVGPDGRFLCSCPPGYQGRSCR

Specifications

• Antigen: NOTCH3
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant NOTCH3.
• Formulation: 50% glycerol
• Gene: NOTCH3
• Gene Accession No.: NM_000435
• Gene Alias: CADASIL/CASIL
• Gene Symbols: NOTCH3
• Host Species: Mouse
• Immunogen: NOTCH3 (NP_000426, 47 a.a. ∽ 156 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 4854
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only