NPSR1 (GPR154), Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant GPR154.

Supplier:  Abnova Corporation H00387129A01

Catalog No. 89-107-785

Description

This gene is a member of the G protein-coupled receptor 1 family and encodes a plasma membrane protein. Increased expression of this gene in ciliated cells of the respiratory epithelium and in bronchial smooth muscle cells is associated with asthma. Mutations in this gene have also been associated with this disease. Alternatively spliced variants which encode different protein isoforms have been described; however, not all variants have been fully characterized. [provided by RefSeq

Sequence: PANFTEGSFDSSGTGQTLDSSPVACTETVTFTEVVEGKEWGSFYYSFKTEQL

Specifications

• Antigen: NPSR1 (GPR154)
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a partial recombinant GPR154.
• Gene: NPSR1
• Gene Alias: ASRT2/GPR154/GPRA/NPSR/PGR14/VRR1
• Host Species: Mouse
• Quantity: 50 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Antisera

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: NM_207173
• Gene Symbols: NPSR1
• Immunogen: GPR154 (NP_997056, 2 a.a. ∽ 53 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Gene ID (Entrez): 387129
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

For Research Use Only