NR1I2, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-105-958	50 μL

Catalog No. 89-105-958 Supplier Abnova Corporation Supplier No. H00008856A01

Description

Mouse polyclonal antibody raised against a partial recombinant NR1I2.

This gene product belongs to the nuclear receptor superfamily, members of which are transcription factors characterized by a ligand-binding domain and a DNA-binding domain. The encoded protein is a transcriptional regulator of the cytochrome P450 gene CYP3A4, binding to the response element of the CYP3A4 promoter as a heterodimer with the 9-cis retinoic acid receptor RXR. It is activated by a range of compounds that induce CYP3A4, including dexamethasone and rifampicin. Several alternatively spliced transcripts encoding different isoforms, some of which use non-AUG (CUG) translation initiation codon, have been described for this gene. Additional transcript variants exist, however, they have not been fully characterized. [provided by RefSeq

Sequence: LHEEEYVLMQAISLFSPDRPGVLQHRVVDQLQEQFAITLKSYIECNRPQPAHRFLFLKIMAMLTELRSINAQHTQRLLRIQDIHPFATPLMQELFGITGS

Specifications

• Antigen: NR1I2
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant NR1I2.
• Formulation: 50% glycerol
• Gene: NR1I2
• Gene Accession No.: BC017304
• Gene Alias: BXR/ONR1/PAR/PAR1/PAR2/PARq/PRR/PXR/SAR/SXR
• Gene Symbols: NR1I2
• Host Species: Mouse
• Immunogen: NR1I2 (AAH17304, 279 a.a. ∽ 378 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 8856
• Target Species: Human, Rat
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only