NRF1, Mouse, Clone: 2F9, Abnova™

Catalog No.	Quantity
89-105-024	200 μL

Catalog No. 89-105-024 Supplier Abnova Corporation Supplier No. H00004899M01A

Description

Mouse monoclonal antibody raised against a partial recombinant NRF1.

This gene encodes a protein that homodimerizes and functions as a transcription factor which activates the expression of some key metabolic genes regulating cellular growth and nuclear genes required for respiration, heme biosynthesis, and mitochondrial DNA transcription and replication. The protein has also been associated with the regulation of neurite outgrowth. Alternate transcriptional splice variants, which encode the same protein, have been characterized. Additional variants encoding different protein isoforms have been described but they have not been fully characterized. Confusion has occurred in bibliographic databases due to the shared symbol of NRF1 for this gene and for nuclear factor (erythroid-derived 2)-like 1 which has an official symbol of NFE2L1. [provided by RefSeq]

Sequence: TQAQLRAFIPEMLKYSTGRGKPGWGKESCKPIWWPEDIPWANVRSDVRTEEQKQRVSWTQALRTIVKNCYKQHGREDLLYAFEDQ

Specifications

• Antigen: NRF1
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 2F9
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant NRF1.
• Formulation: ascites with no preservative
• Gene: NRF1
• Gene Accession No.: NM_005011
• Gene Alias: ALPHA-PAL
• Gene Symbols: NRF1
• Host Species: Mouse
• Immunogen: NRF1 (NP_005002,201 a.a. ∽ 285 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 200 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 4899
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Ascites
• Isotype: IgG1 κ