NSL1 (C1orf48), Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-106-671	50 μL

Catalog No. 89-106-671 Supplier Abnova Corporation Supplier No. H00025936A01

Description

Mouse polyclonal antibody raised against a partial recombinant C1orf48.

This gene encodes a protein with two coiled-coil domains that localizes to kinetochores, which are chromosome-associated structures that attach to microtubules and mediate chromosome movements during cell division. The encoded protein is part of a conserved protein complex that includes two chromodomain-containing proteins and a component of the outer plate of the kinetochore. This protein complex is proposed to bridge centromeric heterochromatin with the outer kinetochore structure. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq

Sequence: KEISEAMKSLPALIEQGEGFSQVLRMQPVIHLQRIHQEVFSSCHRKPDAKPENFITQIETTPTETASRKTSDVVLKRKQTKDCPQRKWYPLRPKKINL

Specifications

• Antigen: NSL1 (C1orf48)
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant C1orf48.
• Formulation: 50% glycerol
• Gene: NSL1
• Gene Accession No.: NM_015471
• Gene Alias: C1orf48/DC8/DKFZp566O1646/MIS14
• Gene Symbols: NSL1
• Host Species: Mouse
• Immunogen: C1orf48 (NP_056286, 182 a.a. ∽ 279 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 25936
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only