NUP133, Mouse, Clone: 4F18, Abnova™

Catalog No.	Quantity
89-107-065	100 μg

Catalog No. 89-107-065 Supplier Abnova Corporation Supplier No. H00055746M09

Description

Mouse monoclonal antibody raised against a partial recombinant NUP133.

The nuclear envelope creates distinct nuclear and cytoplasmic compartments in eukaryotic cells. It consists of two concentric membranes perforated by nuclear pores, large protein complexes that form aqueous channels to regulate the flow of macromolecules between the nucleus and the cytoplasm. These complexes are composed of at least 100 different polypeptide subunits, many of which belong to the nucleoporin family. The nucleoporin protein encoded by this gene displays evolutionarily conserved interactions with other nucleoporins. This protein, which localizes to both sides of the nuclear pore complex at interphase, remains associated with the complex during mitosis and is targeted at early stages to the reforming nuclear envelope. This protein also localizes to kinetochores of mitotic cells. [provided by RefSeq

Sequence: LKLEILCKALQRDNWSSSDGKDDPIEVSKDSIFVKILQKLLKDGIQLSEYLPEVKDLLQADQLGSLKSNPYFEFVLKANYEYYVQGQ

Specifications

• Antigen: NUP133
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 4F18
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant NUP133.
• Formulation: PBS with no preservative; pH 7.4
• Gene: NUP133
• Gene Accession No.: NM_018230
• Gene Alias: FLJ10814/MGC21133/hNUP133
• Gene Symbols: NUP133
• Host Species: Mouse
• Immunogen: NUP133 (NP_060700,1069 a.a. ∽ 1155 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Protein A Purification
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 55746
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Purified
• Isotype: IgG2a κ