NUP214, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-105-799	50 μL

Catalog No. 89-105-799 Supplier Abnova Corporation Supplier No. H00008021A01

Description

Mouse polyclonal antibody raised against a partial recombinant NUP214.

The nuclear pore complex is a massive structure that extends across the nuclear envelope, forming a gateway that regulates the flow of macromolecules between the nucleus and the cytoplasm. Nucleoporins are the main components of the nuclear pore complex in eukaryotic cells. This gene is a member of the FG-repeat-containing nucleoporins. The protein encoded by this gene is localized to the cytoplasmic face of the nuclear pore complex where it is required for proper cell cycle progression and nucleocytoplasmic transport. The 3' portion of this gene forms a fusion gene with the DEK gene on chromosome 6 in a t(6,9) translocation associated with acute myeloid leukemia and myelodysplastic syndrome. [provided by RefSeq]

Sequence: MGDEMDAMIPEREMKDFQFRALKKVRIFDSPEELPKERSSLLAVSNKYGLVFAGGASGLQIFPTKNLLIQNKPGDDPNKIVDKVQGLLVPMKFPIHH

Specifications

• Antigen: NUP214
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant NUP214.
• Formulation: 50% glycerol
• Gene: NUP214
• Gene Accession No.: NM_005085
• Gene Alias: CAIN/CAN/D9S46E/MGC104525/N214
• Gene Symbols: NUP214
• Host Species: Mouse
• Immunogen: NUP214 (NP_005076, 1 a.a. ∽ 97 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 8021
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only