OR2A42, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-107-799	50 μL

Catalog No. 89-107-799 Supplier Abnova Corporation Supplier No. H00402317A01

Description

Mouse polyclonal antibody raised against a partial recombinant OR2A42.

Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms. [provided by RefSeq

Sequence: NGAILGLISLDSRLHTPMYFFLSHLAVVDIAYTRNTVPQMLANLLHPAKPISFAGCMTQT

Specifications

• Antigen: OR2A42
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant OR2A42.
• Formulation: 50% glycerol
• Gene: OR2A42
• Gene Accession No.: NM_001001802
• Gene Symbols: OR2A42
• Host Species: Mouse
• Immunogen: OR2A42 (NP_001001802, 35 a.a. ∽ 94 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 402317
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only