Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

OXSR1 (M06C), Mouse anti-Human, Clone: 1C8, Abnova™

Catalog No. 89106176 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
200 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-106-176 200 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-106-176 Supplier Abnova Corporation Supplier No. H00009943M06C
Add to Cart
Add to Cart

Mouse monoclonal antibody raised against a partial recombinant OXSR1.

The product of this gene belongs to the Ser/Thr protein kinase family of proteins. It regulates downstream kinases in response to environmental stress, and may play a role in regulating the actin cytoskeleton. [provided by RefSeq

Sequence: KAAISQLRSPRVKESISNSELFPTTDPVGTLLQVPEQISAHLPQPAGQIATQPTQVSLPPTAEPAKTAQALSSGSGSQETKIPISLVLRLRNSKKELNDI

Specifications

Antigen OXSR1
Applications ELISA, Western Blot
Classification Monoclonal
Clone 1C8
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant OXSR1.
Formulation tissue culture supernatant with no preservative
Gene OXSR1
Gene Accession No. BC008726.1
Gene Alias KIAA1101/OSR1
Gene Symbols OXSR1
Host Species Mouse
Immunogen OXSR1 (AAH08726.1,351 a.a. ∽ 450 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Quantity 200 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 9943
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Ascites
Isotype IgG3 κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.