PA2G4, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-105-039	50 μL

Catalog No. 89-105-039 Supplier Abnova Corporation Supplier No. H00005036A01

Description

Mouse polyclonal antibody raised against a partial recombinant PA2G4.

This gene encodes an RNA-binding protein that is involved in growth regulation. This protein is present in pre-ribosomal ribonucleoprotein complexes and may be involved in ribosome assembly and the regulation of intermediate and late steps of rRNA processing. This protein can interact with the cytoplasmic domain of the ErbB3 receptor and may contribute to transducing growth regulatory signals. This protein is also a transcriptional co-repressor of androgen receptor-regulated genes and other cell cycle regulatory genes through its interactions with histone deacetylases. This protein has been implicated in growth inhibition and the induction of differentiation of human cancer cells. Six pseudogenes, located on chromosomes 3, 6, 9, 18, 20 and X, have been identified. [provided by RefSeq

Sequence: MSGEDEQQEQTIAEDLVVTKYKMGGDIANRVLRSLVEASSSGVSVLSLCEKGDAMIMEETGKIFKKEKEMKKGIAFPTSISVNNCVCHFSPLKSDQDYILKEGDLVKIDL

Specifications

• Antigen: PA2G4
• Applications: ELISA
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant PA2G4.
• Formulation: 50% glycerol
• Gene: PA2G4
• Gene Accession No.: BC001951
• Gene Alias: EBP1/HG4-1/p38-2G4
• Gene Symbols: PA2G4
• Host Species: Mouse
• Immunogen: PA2G4 (AAH01951, 1 a.a. ∽ 110 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 5036
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only