PADI2, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-106-494	50 μL

Catalog No. 89-106-494 Supplier Abnova Corporation Supplier No. H00011240A01

Description

Mouse polyclonal antibody raised against a partial recombinant PADI2.

This gene encodes a member of the peptidyl arginine deiminase family of enzymes, which catalyze the post-translational deimination of proteins by converting arginine residues into citrullines in the presence of calcium ions. The family members have distinct substrate specificities and tissue-specific expression patterns. The type II enzyme is the most widely expressed family member. Known substrates for this enzyme include myelin basic protein in the central nervous system and vimentin in skeletal muscle and macrophages. This enzyme is thought to play a role in the onset and progression of neurodegenerative human disorders, including Alzheimer disease and multiple sclerosis, and it has also been implicated in glaucoma pathogenesis. This gene exists in a cluster with four other paralogous genes. [provided by RefSeq]

Sequence: MLRERTVRLQYGSRVEAVYVLGTYLWTDVYSAAPAGAQTFSLKHSEHVWVEVVRDGEAEEVATNGKQRWLLSPSTTLRVTMSQASTEASSDKVTVNYYDEEGSIPIDQ

Specifications

• Antigen: PADI2
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant PADI2.
• Formulation: 50% glycerol
• Gene: PADI2
• Gene Accession No.: NM_007365
• Gene Alias: KIAA0994/PAD-H19/PAD2/PDI2
• Gene Symbols: PADI2
• Host Species: Mouse
• Immunogen: PADI2 (NP_003008, 1 a.a. ∽ 108 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 11240
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only