PAFAH1B1, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-105-042	50 μL

Catalog No. 89-105-042 Supplier Abnova Corporation Supplier No. H00005048A01

Description

Mouse polyclonal antibody raised against a partial recombinant PAFAH1B1.

This locus was identified as encoding a gene that when mutated or lost caused the lissencephaly associated with Miller-Dieker lissencephaly syndrome. This gene encodes the noncatalytic alpha subunit of the intracellular Ib isoform of platelet-activating factor acteylhydrolase, a heterotrimeric enzyme that specifically catalyzes the removal of the acetyl group at the SN-2 position of platelet-activating factor (identified as 1-O-alkyl-2-acetyl-sn-glyceryl-3-phosphorylcholine). Two other isoforms of intracellular platelet-activating factor acetylhydrolase exist: one composed of multiple subunits, the other, a single subunit. In addition, a single-subunit isoform of this enzyme is found in serum. [provided by RefSeq

Sequence: MVLSQRQRDELNRAIADYLRSNGYEEAYSVFKKEAELDVNEELDKKYAGLLEKKWTSVIRLQKKVMELESKLNEAKEEFTSGGPLGQKRDPKEWIPRPPEKYALSGHRSP

Specifications

• Antigen: PAFAH1B1
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant PAFAH1B1.
• Formulation: 50% glycerol
• Gene: PAFAH1B1
• Gene Accession No.: NM_000430
• Gene Alias: LIS1/LIS2/MDCR/MDS/PAFAH
• Gene Symbols: PAFAH1B1
• Host Species: Mouse
• Immunogen: PAFAH1B1 (NP_000421, 1 a.a. ∽ 110 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 5048
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only