PAFAH1B2, Mouse, Clone: 2F4-1C10, Abnova™

Catalog No.	Quantity
89-105-043	200 μL

Catalog No. 89-105-043 Supplier Abnova Corporation Supplier No. H00005049M01A

Description

Mouse monoclonal antibody raised against a full-length recombinant PAFAH1B2.

Platelet-activating factor (PAF) is a biologically active phospholipid with diverse biologic effects. PAF is degraded to inactive products by hydrolysis of the acetyl group at the sn-2 position to produce the biologically inactive products LYSO-PAF and acetate. This reaction is catalyzed by PAF acetylhydrolase (PAFAH). The various monomeric and multimeric forms of the enzyme are composed of alpha (MIM 601545), beta, and gamma (MIM 603074) PAFAH subunits.[supplied by OMIM

Sequence: MSQGDSNPAAIPHAAEDIQGDDRWMSQHNRFVLDCKDKEPDVLFVGDSMVQLMQQYEIWRELFSPLHALNFGIGGDTTRHVLWRLKNGELENIKPKVIVVWVGTNNHENTAEEVAGGIEAIVQLINTRQPQAKIIVLGLLPRGEKPNPLRQKNAKVNQLLKVSLPKLANVQLLDTDGGFVHSDGAISCHDMFDFLHLTGGGYAKICKPLHELIMQLLEETPEEKQTTIA

Specifications

• Antigen: PAFAH1B2
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 2F4-1C10
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a full-length recombinant PAFAH1B2.
• Formulation: ascites with no preservative
• Gene: PAFAH1B2
• Gene Accession No.: BC000398
• Gene Symbols: PAFAH1B2
• Host Species: Mouse
• Immunogen: PAFAH1B2 (AAH00398,1 a.a. ∽ 229 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 200 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 5049
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Ascites
• Isotype: IgM κ