PC-LKC, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant PC-LKC.

Supplier:  Abnova Corporation H00054825A01

Catalog No. 89-106-990

Description

This gene is a member of the protocadherin family, which represents a subset of the larger cadherin superfamily. The members of the protocadherin family encode nonclassical cadherins that function as calcium-dependent cell-cell adhesion molecules. The kidney-expressed gene product has a signal peptide, nine cadherin repeat domains and a unique cytoplasmic region. This protocadherin represents a new candidate for tumor suppression. [provided by RefSeq

Sequence: GGMYHNTFTIQCSLPVFLSISVVDQPDLDPQFVREFYSASVAEDAAKGTSVLTVEAVDGDKGINDPVIYSISYSTRPGWFDIGADGVIRVNGSLDREQLLEADEEVQLQ

Specifications

• Antigen: PC-LKC
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a partial recombinant PC-LKC.
• Gene: PCDH24
• Gene Alias: FLJ20124/FLJ20383/MGC163154/PC-LKC/PCLKC
• Host Species: Mouse
• Quantity: 50 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Antisera

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: NM_017675
• Gene Symbols: PCDH24
• Immunogen: PC-LKC (NP_060145, 210 a.a. ∽ 318 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Gene ID (Entrez): 54825
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

For Research Use Only