PCDH11X, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-106-769	50 μL

Catalog No. 89-106-769 Supplier Abnova Corporation Supplier No. H00027328A01

Description

Mouse polyclonal antibody raised against a partial recombinant PCDH11X.

This gene belongs to the protocadherin gene family, a subfamily of the cadherin superfamily. The encoded protein consists of an extracellular domain containing 7 cadherin repeats, a transmembrane domain and a cytoplasmic tail that differs from those of the classical cadherins. The gene is located in a major X/Y block of homology and its Y homolog, despite divergence leading to coding region changes, is the most closely related cadherin family member. The protein is thought to play a fundamental role in cell-cell recognition essential for the segmental development and function of the central nervous system. Transcripts arising from alternative splicing encode isoforms with variable cytoplasmic domains. [provided by RefSeq

Sequence: AQASALCYSPPLAQAAAISHSSPLPQVIALHRSQAQSSVSLQQGWVQGADGLCSVDQGVQGSATSQFYTMSERLHPSDDSIKVIPLTTFTPRQQARPSRGDSPIMEEHP

Specifications

• Antigen: PCDH11X
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant PCDH11X.
• Formulation: 50% glycerol
• Gene: PCDH11X
• Gene Accession No.: NM_032969
• Gene Alias: PCDH-X/PCDH11/PCDHX/PCDHY
• Gene Symbols: PCDH11X
• Host Species: Mouse
• Immunogen: PCDH11X (NP_061850, 1228 a.a. ∽ 1336 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 27328
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only