PCNA (A02), Mouse anti-Human, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-105-065	50 μL

Catalog No. 89-105-065 Supplier Abnova Corporation Supplier No. H00005111A02

Description

Mouse polyclonal antibody raised against a partial recombinant PCNA.

The protein encoded by this gene is found in the nucleus and is a cofactor of DNA polymerase delta. The encoded protein acts as a homotrimer and helps increase the processivity of leading strand synthesis during DNA replication. In response to DNA damage, this protein is ubiquitinated and is involved in the RAD6-dependent DNA repair pathway. Two transcript variants encoding the same protein have been found for this gene. Pseudogenes of this gene have been described on chromosome 4 and on the X chromosome. [provided by RefSeq

Sequence: SHIGDAVVISCAKDGVKFSASGELGNGNIKLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYLAPKIEDEEGS

Specifications

• Antigen: PCNA
• Applications: ELISA
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant PCNA.
• Formulation: 50% glycerol
• Gene: PCNA
• Gene Accession No.: NM_002592
• Gene Alias: MGC8367
• Gene Symbols: PCNA
• Host Species: Mouse
• Immunogen: PCNA (NP_002583, 152 a.a. ∽ 261 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 5111
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only