PDK4 (A01), Mouse anti-Human, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant PDK4.

Supplier:  Abnova Corporation H00005166A01

Catalog No. 89-105-077

Description

This gene is a member of the PDK/BCKDK protein kinase family and encodes a mitochondrial protein with a histidine kinase domain. This protein is located in the matrix of the mitrochondria and inhibits the pyruvate dehydrogenase complex by phosphorylating one of its subunits, thereby contributing to the regulation of glucose metabolism. Expression of this gene is regulated by glucocorticoids, retinoic acid and insulin. [provided by RefSeq

Sequence: SDSQTGNPSHIGSIDPNCDVVAVVQDAFGCSRMLCDQYYLSSPELKLTQANGKFPDQPIHIVYVPSHLHHMLFELFKNAMRATVEHQENQPSLTPIEVIV

Specifications

• Antigen: PDK4
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a partial recombinant PDK4.
• Gene: PDK4
• Gene Alias: FLJ40832
• Host Species: Mouse
• Quantity: 50 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Antisera

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: BC040239
• Gene Symbols: PDK4
• Immunogen: PDK4 (AAH40239, 181 a.a. ∽ 280 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Gene ID (Entrez): 5166
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

For Research Use Only