Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

PDZK1IP1, Mouse, Clone: 4D11, Abnova™

Mouse monoclonal antibody raised against a full-length recombinant PDZK1IP1.

Manufacturer:  Abnova Corporation H00010158M06

Catalog No. 89-106-230


Add to cart

Description

Description

Sequence: MSALSLLILGLLTAVPPASCQQGLGNLQPWMQGLIAVAVFLVLVAIAFAVNHFWCQEEPEPAHMILTVGNKADGVLVGTDGRYSSMAASFRSSEHENAYENVPEEEGKVRSTPM
Specifications

Specifications

PDZK1IP1
Monoclonal
Unconjugated
PBS with no preservative; pH 7.4
NM_005764.3
DD96/MAP17/RP1-18D14.5/SPAP
Mouse
IgG2a Kappa
100 ug
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Primary
10158
ELISA, Western Blot
4D11
Mouse monoclonal antibody raised against a full-length recombinant PDZK1IP1.
PDZK1IP1
Purified
PDZK1IP1
PDZK1IP1 (NP_005755.1,1 a.a. ∽ 114 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Protein A Purification
RUO
Antibody
Monoclonal
Human
SDS
Documents
Product Certifications
Promotions

Promotions

Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit