Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

PELP1, Mouse, Clone: 2B6, Abnova™

Catalog No. 89106732 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
200 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-106-732 200 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-106-732 Supplier Abnova Corporation Supplier No. H00027043M03A
Add to Cart
Add to Cart

Mouse monoclonal antibody raised against a partial recombinant PELP1.

PELP1 is a coactivator of estrogen receptor (see ESR1; MIM 133430)-mediated transcription and a corepressor of other nuclear hormone receptors and sequence-specific transcription factors (Choi et al., 2004 [PubMed 15456770]).[supplied by OMIM

Sequence: LNSWSIGRDSLSPGQERPYSTVRTKVYAILELWVQVCGASAGMLQGGASGEALLTHLLSDISPPADALKLRSPR

Specifications

Antigen PELP1
Applications ELISA
Classification Monoclonal
Clone 2B6
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant PELP1.
Formulation ascites with no preservative
Gene PELP1
Gene Accession No. AY882602
Gene Alias HMX3/MNAR/P160
Gene Symbols PELP1
Host Species Mouse
Immunogen PELP1 (AAW80659.1,337 a.a. ∽ 410 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Quantity 200 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 27043
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Ascites
Isotype IgM κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.