Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

PF4, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant PF4.

Manufacturer:  Abnova Corporation H00005196A01

Catalog No. 89-105-089


Add to cart

Description

Description

Platelet factor-4 is a 70-amino acid protein that is released from the alpha-granules of activated platelets and binds with high affinity to heparin. Its major physiologic role appears to be neutralization of heparin-like molecules on the endothelial surface of blood vessels, thereby inhibiting local antithrombin III activity and promoting coagulation. As a strong chemoattractant for neutrophils and fibroblasts, PF4 probably has a role in inflammation and wound repair (Eisman et al., 1990 [PubMed 1695112]).[supplied by OMIM

Sequence: AEAEEDGDLQCLCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQAPLYKKIIKKLLES
Specifications

Specifications

PF4
Unconjugated
50% glycerol
NM_002619
CXCL4/MGC138298/SCYB4
Mouse
50 uL
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Polyclonal
Human
ELISA, Western Blot
Mouse polyclonal antibody raised against a partial recombinant PF4.
PF4
Antisera
PF4
PF4 (NP_002610, 31 a.a. ∽ 101 a.a) partial recombinant protein with GST tag.
RUO
Primary
5196
SDS
Documents
Product Certifications
Promotions

Promotions

Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only