PIAS3, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-106-303	50 μL

Catalog No. 89-106-303 Supplier Abnova Corporation Supplier No. H00010401A01

Description

Mouse polyclonal antibody raised against a partial recombinant PIAS3.

This gene encodes a member of the PIAS [protein inhibitor of activated STAT (signal transducer and activator of transcription)] family of transcriptional modulators. The protein functions as a SUMO (small ubiquitin-like modifier)-E3 ligase which catalyzes the covalent attachment of a SUMO protein to specific target substrates. It directly binds to several transcription factors and either blocks or enhances their activity. Alternatively spliced transcript variants of this gene have been identified, but the full-length nature of some of these variants has not been determined. [provided by RefSeq

Sequence: PPTKKHCSVTSAAIPALPGSKGVLTSGHQPSSVLRSPAMGTLGGDFLSSLPLHEYPPAFPLGADIQGLDLFSFLQTESQHYGPSVITSLDEQDALGHF

Specifications

• Antigen: PIAS3
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant PIAS3.
• Formulation: 50% glycerol
• Gene: PIAS3
• Gene Accession No.: NM_006099
• Gene Alias: FLJ14651/ZMIZ5
• Gene Symbols: PIAS3
• Host Species: Mouse
• Immunogen: PIAS3 (NP_006090, 453 a.a. ∽ 550 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 10401
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only