PIK3C2A, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-105-113	50 μL

Catalog No. 89-105-113 Supplier Abnova Corporation Supplier No. H00005286A01

Description

Mouse polyclonal antibody raised against a partial recombinant PIK3C2A.

The protein encoded by this gene belongs to the phosphoinositide 3-kinase (PI3K) family. PI3-kinases play roles in signaling pathways involved in cell proliferation, oncogenic transformation, cell survival, cell migration, and intracellular protein trafficking. This protein contains a lipid kinase catalytic domain as well as a C-terminal C2 domain, a characteristic of class II PI3-kinases. C2 domains act as calcium-dependent phospholipid binding motifs that mediate translocation of proteins to membranes, and may also mediate protein-protein interactions. The PI3-kinase activity of this protein is not sensitive to nanomolar levels of the inhibitor wortmanin. This protein was shown to be able to be activated by insulin and may be involved in integrin-dependent signaling. [provided by RefSeq

Sequence: MVMHIKDLVTEDGADPNPYVKTYLLPDNHKTSKRKTKISRKTRNPTFNEMLVYSGYSKETLRQRELQLSVLSAESLRENFFLGGVTLPLKDFNLSKETVKWYQLTAATYL

Specifications

• Antigen: PIK3C2A
• Applications: ELISA
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant PIK3C2A.
• Formulation: 50% glycerol
• Gene: PIK3C2A
• Gene Accession No.: NM_002645
• Gene Alias: CPK/DKFZp686L193/MGC142218/PI3-K-C2(ALPHA)/PI3-K-C2A
• Gene Symbols: PIK3C2A
• Host Species: Mouse
• Immunogen: PIK3C2A (NP_002636, 1577 a.a. ∽ 1686 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 5286
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only