PIK3C2B, Mouse, Clone: 3E5, Abnova™

Catalog No.	Quantity
89-105-115	200 μL

Catalog No. 89-105-115 Supplier Abnova Corporation Supplier No. H00005287M02A

Description

Mouse monoclonal antibody raised against a partial recombinant PIK3C2B.

The protein encoded by this gene belongs to the phosphoinositide 3-kinase (PI3K) family. PI3-kinases play roles in signaling pathways involved in cell proliferation, oncogenic transformation, cell survival, cell migration, and intracellular protein trafficking. This protein contains a lipid kinase catalytic domain as well as a C-terminal C2 domain, a characteristic of class II PI3-kinases. C2 domains act as calcium-dependent phospholipid binding motifs that mediate translocation of proteins to membranes, and may also mediate protein-protein interactions. The PI3-kinase activity of this protein is sensitive to low nanomolar levels of the inhibitor wortmanin. The C2 domain of this protein was shown to bind phospholipids but not Ca2+, which suggests that this enzyme may function in a calcium-independent manner. [provided by RefSeq]

Sequence: MSSTQDNGEHWKSLESVGISRKELAMAEALQMEYDALSRLRHDKEENRAKQNADPSLISWDEPGVDFYSKPAGRRTDLKLLRGLSGSDPTLNYNSLSPQEGPPNHSTSQG

Specifications

• Antigen: PIK3C2B
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 3E5
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant PIK3C2B.
• Formulation: ascites with no preservative
• Gene: PIK3C2B
• Gene Accession No.: NM_002646
• Gene Alias: C2-PI3K/DKFZp686G16234
• Gene Symbols: PIK3C2B
• Host Species: Mouse
• Immunogen: PIK3C2B (NP_002637,1 a.a. ∽ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 200 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 5287
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Ascites
• Isotype: IgG2b κ