Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89105119

PIK3CB, Mouse, Polyclonal Antibody, Abnova™

Catalog No. 89105119 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
50 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-105-119 50 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-105-119 Supplier Abnova Corporation Supplier No. H00005291A01
Add to Cart
Add to Cart

Description

Mouse polyclonal antibody raised against a partial recombinant PIK3CB.

Phosphoinositide 3-kinases (PI3Ks) phosphorylate the 3-prime OH position of the inositol ring of inositol lipids. They have been implicated as participants in signaling pathways regulating cell growth by virtue of their activation in response to various mitogenic stimuli. PI3Ks are composed of a 110kDa catalytic subunit, such as PIK3CB, and an 85kDa adaptor subunit (Hu et al., 1993 [PubMed 8246984]).[supplied by OMIM

Sequence: EFRRKMRKFSEEKILSLVGLSWMDWLKQTYPPEHEPSIPENLEDKLYGGKLIVAVHFENCQDVFSFQVSPNMNPIKVNELAIQKRLTIHGKEDEVSPYDYVLQVSGRVEY

Specifications

Antigen PIK3CB
Applications ELISA
Classification Polyclonal
Conjugate Unconjugated
Description Mouse polyclonal antibody raised against a partial recombinant PIK3CB.
Formulation 50% glycerol
Gene PIK3CB
Gene Accession No. NM_006219
Gene Alias DKFZp779K1237/MGC133043/PI3K/PI3KCB/PI3Kbeta/PIK3C1/p110-BETA
Gene Symbols PIK3CB
Host Species Mouse
Immunogen PIK3CB (NP_006210, 147 a.a. ∽ 256 a.a) partial recombinant protein with GST tag.
Quantity 50 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 5291
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Form Antisera
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.