PIK3R6 (C17orf38), Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-107-644	50 μL

Catalog No. 89-107-644 Supplier Abnova Corporation Supplier No. H00146850A01

Description

Mouse polyclonal antibody raised against a partial recombinant C17orf38.

Phosphoinositide 3-kinase gamma is a lipid kinase that produces the lipid second messenger phosphatidylinositol 3,4,5-trisphosphate. The kinase is composed of a catalytic subunit and one of several regulatory subunits, and is chiefly activated by G protein-coupled receptors. This gene encodes a regulatory subunit, and is distantly related to the phosphoinositide-3-kinase, regulatory subunit 5 gene which is located adjacent to this gene on chromosome 7. The orthologous protein in the mouse binds to both the catalytic subunit and to G(beta/gamma), and mediates activation of the kinase subunit downstream of G protein-coupled receptors. [provided by RefSeq

Sequence: GKSFSTVTNTFRTNNIQIQSRDQRLLTLSLDKDDQRTFRDVVRFEVAPCPEPCSGAQKSKAPWLNLHGQQEVEAIKAKPKPLLMPINTFSGIVQ

Specifications

• Antigen: PIK3R6 (C17orf38)
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant C17orf38.
• Formulation: 50% glycerol
• Gene: PIK3R6
• Gene Accession No.: NM_001010855
• Gene Alias: C17orf38/DKFZp666P158/FLJ34500/HsT41028/p84/p87(PIKAP)/p87PIKAP
• Gene Symbols: PIK3R6
• Host Species: Mouse
• Immunogen: C17orf38 (NP_001010855, 661 a.a. ∽ 754 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 146850
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only