Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

PIP4K2C, Mouse, Clone: 3A4, Abnova™

Mouse monoclonal antibody raised against a partial recombinant PIP4K2C.

Manufacturer:  Abnova Corporation H00079837M01A

Catalog No. 89-107-342


Add to cart

Description

Description

Sequence: DGDCSLTGPPALVGSYGTSPEGIGGYIHSHRPLGPGEFESFIDVYAIRSAEGAPQKEVYFMGLIDILTQYDA
Specifications

Specifications

PIP4K2C
Monoclonal
Unconjugated
ascites with no preservative
NM_024779
FLJ22055/PIP5K2C
Mouse
IgG
RUO
Antibody
Monoclonal
Human
ELISA, Western Blot
3A4
Mouse monoclonal antibody raised against a partial recombinant PIP4K2C.
PIP4K2C
Ascites
PIP4K2C
PIP4K2C (NP_079055.2,310 a.a. ∽ 381 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
200 uL
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Primary
79837
SDS
Documents
Product Certifications
Promotions

Promotions

Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit