Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89107342

PIP4K2C, Mouse, Clone: 3A4, Abnova™

Catalog No. 89107342 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
200 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-107-342 200 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-107-342 Supplier Abnova Corporation Supplier No. H00079837M01A
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a partial recombinant PIP4K2C.

Sequence: DGDCSLTGPPALVGSYGTSPEGIGGYIHSHRPLGPGEFESFIDVYAIRSAEGAPQKEVYFMGLIDILTQYDA

Specifications

Antigen PIP4K2C
Applications ELISA, Western Blot
Classification Monoclonal
Clone 3A4
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant PIP4K2C.
Formulation ascites with no preservative
Gene PIP4K2C
Gene Accession No. NM_024779
Gene Alias FLJ22055/PIP5K2C
Gene Symbols PIP4K2C
Host Species Mouse
Immunogen PIP4K2C (NP_079055.2,310 a.a. ∽ 381 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Quantity 200 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 79837
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Ascites
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.