PKM2, Mouse, Clone: 2D8, Abnova™

Catalog No.	Quantity
89-105-128	200 μL

Catalog No. 89-105-128 Supplier Abnova Corporation Supplier No. H00005315M08A

Description

Mouse monoclonal antibody raised against a partial recombinant PKM2.

This gene encodes a protein involved in glycolysis. The encoded protein is a pyruvate kinase that catalyzes the transfer of a phosphoryl group from phosphoenolpyruvate to ADP, generating ATP and pyruvate. This protein has been shown to interact with thyroid hormone and may mediate cellular metabolic effects induced by thyroid hormones. This protein has been found to bind Opa protein, a bacterial outer membrane protein involved in gonococcal adherence to and invasion of human cells, suggesting a role of this protein in bacterial pathogenesis. Three alternatively spliced transcript variants encoding two distinct isoforms have been reported. [provided by RefSeq

Sequence: RSAHQVARYRPRAPIIAVTRNPQTARQAHLYRGIFPVLCKDPVQEAWAEDVDLRVNFAMNVGKARGFFKKGDVVIVLTGWRPGSGFTNTMRVVPVP

Specifications

• Antigen: PKM2
• Applications: ELISA
• Classification: Monoclonal
• Clone: 2D8
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant PKM2.
• Formulation: ascites with no preservative
• Gene: PKM2
• Gene Accession No.: NM_002654
• Gene Alias: CTHBP/MGC3932/OIP3/PK3/PKM/TCB/THBP1
• Gene Symbols: PKM2
• Host Species: Mouse
• Immunogen: PKM2 (NP_002645,436 a.a. ∽ 531 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 200 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 5315
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Ascites
• Isotype: IgG2a κ