PKP4, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-105-870	50 μL

Catalog No. 89-105-870 Supplier Abnova Corporation Supplier No. H00008502A01

Description

Mouse polyclonal antibody raised against a partial recombinant PKP4.

Armadillo-like proteins are characterized by a series of armadillo repeats, first defined in the Drosophila 'armadillo' gene product, that are typically 42 to 45 amino acids in length. These proteins can be divided into subfamilies based on their number of repeats, their overall sequence similarity, and the dispersion of the repeats throughout their sequences. Members of the p120(ctn)/plakophilin subfamily of Armadillo-like proteins, including CTNND1, CTNND2, PKP1, PKP2, PKP4, and ARVCF. PKP4 may be a component of desmosomal plaque and other adhesion plaques and is thought to be involved in regulating junctional plaque organization and cadherin function. Multiple transcript variants have been found for this gene, but the full-length nature of only two of them have been described so far. These two variants encode distinct isoforms. [provided by RefSeq]

Sequence: EGQPQTRQEAASTGPGMEPETTATTILASVKEQELQFQRLTRELEVERQIVASQLERCRLGAESPSIASTSSTEKSFPWRSTDVPNTGVSKPRVSDAVQ

Specifications

• Antigen: PKP4
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant PKP4.
• Formulation: 50% glycerol
• Gene: PKP4
• Gene Accession No.: NM_001005476
• Gene Alias: FLJ31261/FLJ42243/p0071
• Gene Symbols: PKP4
• Host Species: Mouse
• Immunogen: PKP4 (NP_001005476, 12 a.a. ∽ 110 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 8502
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only