PLAUR (B01P), Mouse anti-Human, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-105-136	50 μg

Catalog No. 89-105-136 Supplier Abnova Corporation Supplier No. H00005329B01P

Description

Mouse polyclonal antibody raised against a full-length human PLAUR protein.

This gene encodes the receptor for urokinase plasminogen activator and, given its role in localizing and promoting plasmin formation, likely influences many normal and pathological processes related to cell-surface plasminogen activation and localized degradation of the extracellular matrix. It binds both the proprotein and mature forms of urokinase plasminogen activator and permits the activation of the receptor-bound pro-enzyme by plasmin. The protein lacks transmembrane or cytoplasmic domains and may be anchored to the plasma membrane by a glycosyl-phosphatidylinositol (GPI) moiety following cleavage of the nascent polypeptide near its carboxy-terminus. However, a soluble protein is also produced in some cell types. Alternative splicing results in multiple transcript variants encoding different isoforms. The proprotein experiences several post-translational cleavage reactions that have not yet been fully defined. [provided by RefSeq

Sequence: MGHPPLLPLLLLLHTCVPASWGLRCMQCKTNGDCRVEECALGQDLCRTTIVRLWEEGEELELVEKSCTHSEKTNRTLSYRTGLKITSLTEVVCGLDLCNQGNSGRAVTYSRSRYLECISCGSSDMSCERGRHQSLQCRSPEEQCLDVVTHWIQEGEEGRPKDDRHLRGCGYLPGCPGSNGFHNNDTFHFLKCCNTTKCNEGPILELENLPQNGRQCYSCKGNSTHGCSSEETFLIDCRGPMNQCLVATGTHEPKNQSYMVRGCATASMCQHAHLGDAFSMNHIDVSCCTKSGCNHPDLDVQYRSGAAPQPGPAHLSLTITLLMTARLWGGTLLWT

Specifications

• Antigen: PLAUR
• Applications: Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a full-length human PLAUR protein.
• Formulation: PBS with no preservative; pH 7.2
• Gene: PLAUR
• Gene Accession No.: NM_002659
• Gene Alias: CD87/UPAR/URKR
• Gene Symbols: PLAUR
• Host Species: Mouse
• Immunogen: PLAUR (NP_002650.1,1 a.a. ∽ 335 a.a) full-length human protein.
• Purification Method: Affinity chromatography
• Quantity: 50 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 5329
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Purified
• Isotype: IgG

For Research Use Only