PLCG1, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-105-141	50 μL

Catalog No. 89-105-141 Supplier Abnova Corporation Supplier No. H00005335A01

Description

Mouse polyclonal antibody raised against a partial recombinant PLCG1.

The protein encoded by this gene catalyzes the formation of inositol 1,4,5-trisphosphate and diacylglycerol from phosphatidylinositol 4,5-bisphosphate. This reaction uses calcium as a cofactor and plays an important role in the intracellular transduction of receptor-mediated tyrosine kinase activators. For example, when activated by SRC, the encoded protein causes the Ras guanine nucleotide exchange factor RasGRP1 to translocate to the Golgi, where it activates Ras. Also, this protein has been shown to be a major substrate for heparin-binding growth factor 1 (acidic fibroblast growth factor)-activated tyrosine kinase. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq

Sequence: LKNNYSEDLELASLLIKIDIFPAKQENGDLSPFSGTSLRERGSDASGQLFHGRAREGSFESRYQQPFEDFRISQEHLADHFDSRERRAPRRTRVNGDNRL

Specifications

• Antigen: PLCG1
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant PLCG1.
• Formulation: 50% glycerol
• Gene: PLCG1
• Gene Accession No.: NM_002660
• Gene Alias: PLC-II/PLC1/PLC148/PLCgamma1
• Gene Symbols: PLCG1
• Host Species: Mouse
• Immunogen: PLCG1 (NP_002651, 1192 a.a. ∽ 1291 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 5335
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only